PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 336aa    MW: 38085.4 Da    PI: 8.3783
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600706.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.88.9e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+d ++++G+g +W + +++ g++R++k+c++rw++yl
   XP_009600706.1 14 RGPWSPEEDAKLKDFIHKYGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding377.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd  +  +    G++ W+ Ia+ ++ gRt++++k++w++
   XP_009600706.1  69 GDFSEEEDRVICSLYSTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      689******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.358962IPR017930Myb domain
SuperFamilySSF466891.23E-2711109IPR009057Homeodomain-like
SMARTSM007171.1E-121364IPR001005SANT/Myb domain
PfamPF002491.0E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-241569IPR009057Homeodomain-like
CDDcd001677.89E-101662No hitNo description
PROSITE profilePS5129422.16463117IPR017930Myb domain
SMARTSM007172.2E-1167115IPR001005SANT/Myb domain
PfamPF002491.0E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2370117IPR009057Homeodomain-like
CDDcd001675.43E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDAKLKDFIH KYGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSEEEDRVIC SLYSTIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGL  120
MQSTNQRKSP YFPATNSLQT QPQINSSLFR DLYYNPNNRP IITGLNQSIS SAHQPNFLYT  180
NSNMNFPNLG ATNSQYPYNI QSHNLLMFGE ASCSSSDGSC SQMSFGKEIK REEIMSNCLQ  240
QGQISSVNAF EENQNFTLDY GNSSSNWVDQ KPNVYFGNTT TTTQVLQYDV EEVKQQLTSC  300
TNGNNGSTIG CNNNNSMFVF NDENYNKSNE IGMFYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600706.10.0PREDICTED: transcription factor RAX2-like
RefseqXP_016497782.10.0PREDICTED: transcription factor RAX2-like
TrEMBLF5C7S01e-115F5C7S0_CAPAN; BLIND
STRINGSolyc11g069030.1.11e-108(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.19e-81myb domain protein 36